1j3w/1/1:C/1:B

Sequences
>1j3w-a1-m1-cC (length=133) [Search sequence]
LVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVAG
NAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRA
SEALARIAEEALA
>1j3w-a1-m1-cB (length=135) [Search sequence]
VEPSLVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLAT
LVAGNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLH
GKRASEALARIAEEA
Structure information
PDB ID 1j3w (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Gliding protein-mglB from Thermus Thermophilus HB8
Assembly ID 1
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 14
Sequence identity between the two chains 0.985
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession Q9X9L0 Q9X9L0
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1j3w-a1-m1-cC_1j3w-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1j3w-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1j3w/1/1:D/1:A 3t1r/3/1:A/1:D 3t1r/3/1:B/1:C
Other dimers with similar sequences but different poses
  • 1j3w/1/1:D/1:B 1j3w/1/1:C/1:A 3t1r/3/1:A/1:C 3t1r/3/1:B/1:D
  • 1j3w/2/2:C/2:D 1j3w/1/1:C/1:D 1j3w/2/1:C/1:D 3t12/1/1:B/1:C 3t1q/1/1:B/1:C 3t1r/2/1:D/1:C 3t1r/3/1:D/1:C 3t1s/1/1:A/2:A 3t1x/1/1:A/2:A
  • 1j3w/2/1:D/4:B 1j3w/2/1:C/4:A 1j3w/2/2:C/3:A 1j3w/2/2:D/3:B
  • [Back to Home]