1j55/1/1:A/2:A

Sequences
>1j55-a1-m1-cA (length=88) [Search sequence]
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLDAVDKLLKDLDANGD
AQVDFSEFIVFVAAITSACHKYFEKAGL
>1j55-a1-m2-cA (length=88) [Search sequence]
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLDAVDKLLKDLDANGD
AQVDFSEFIVFVAAITSACHKYFEKAGL
Structure information
PDB ID 1j55 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Crystal Structure of Ca+-bound Human S100P Determined at 2.0A Resolution by X-ray
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 97
Sequence identity between the two chains 1.0
PubMed citation 12507480
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P25815 P25815
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1j55A BioLiP:1j55A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1j55-a1-m1-cA_1j55-a1-m2-cA.pdb.gz
Full biological assembly
Download: 1j55-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1ozo/1/1:A/1:B 2mjw/1/1:B/1:D

[Back to Home]