1jfz/2/1:D/1:C

Sequences
>1jfz-a2-m1-cD (length=148) [Search sequence]
GMKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYS
PNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYID
SGRDANFTRELFYKLFKEDILSAIKEGR
>1jfz-a2-m1-cC (length=149) [Search sequence]
GMKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYS
PNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYID
SGRDANFTRELFYKLFKEDILSAIKEGRH
Structure information
PDB ID 1jfz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of MN(II)-Complex of RNAse III Endonuclease Domain from Aquifex Aeolicus at 2.10 Angstrom Resolution
Assembly ID 2
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 63
Sequence identity between the two chains 1.0
PubMed citation 11738048
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession O67082 O67082
Species 63363 (Aquifex aeolicus) 63363 (Aquifex aeolicus)
Function annotation BioLiP:1jfzD BioLiP:1jfzC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1jfz-a2-m1-cD_1jfz-a2-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1jfz-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1i4s/1/1:A/1:B 1jfz/1/1:A/1:B 1rc5/1/1:A/1:B 1rc5/2/1:D/1:C 1rc7/1/1:A/2:A 1yyk/1/1:A/1:B 1yyo/1/1:B/1:A 1yz9/1/1:B/1:A 2nue/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 1yyw/2/1:C/1:D 1yyw/1/1:A/1:B
  • 4m30/1/1:B/1:A 2ez6/1/1:A/1:B 2nuf/1/1:A/1:B 2nug/1/1:A/1:B 4m2z/1/1:B/1:A
    		•

    [Back to Home]