1jl9/1/1:A/1:B

Sequences
>1jl9-a1-m1-cA (length=42) [Search sequence]
CPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDL
>1jl9-a1-m1-cB (length=45) [Search sequence]
CPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
Structure information
PDB ID 1jl9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Human Epidermal Growth Factor
Assembly ID 1
Resolution 3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P01133 P01133
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1jl9-a1-m1-cA_1jl9-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1jl9-assembly1.cif.gz

[Back to Home]