1jpx/1/2:A/3:A

Sequences
>1jpx-a1-m2-cA (length=59) [Search sequence]
GIVQQQQQLLDVVKRQQELLRLTVWGTKQEWERKVDFLEENITALLEEAQIQQEKNMYE
>1jpx-a1-m3-cA (length=59) [Search sequence]
GIVQQQQQLLDVVKRQQELLRLTVWGTKQEWERKVDFLEENITALLEEAQIQQEKNMYE
Structure information
PDB ID 1jpx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Mutation that destabilize the gp41 core: determinants for stabilizing the SIV/CPmac envelope glycoprotein complex. Wild type.
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 65
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession S4WCF9 S4WCF9
Species 11723 (Simian immunodeficiency virus) 11723 (Simian immunodeficiency virus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1jpx-a1-m2-cA_1jpx-a1-m3-cA.pdb.gz
Full biological assembly
Download: 1jpx-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1jpx/1/1:A/2:A 1jpx/1/1:A/3:A 1jpx/2/1:D/4:D 1jpx/2/1:D/5:D 1jpx/2/4:D/5:D 1jpx/3/1:G/6:G 1jpx/3/1:G/7:G 1jpx/3/6:G/7:G

[Back to Home]