1jq3/1/1:C/1:D

Sequences

>1jq3-a1-m1-cC (length=293) [Search sequence]

LKELERELQPRQHLWYFEYYTGNNVGLFMKMNRVIYSGQSDIQRIDIFENPDLGVVFALD
GITMTTEKDEFMYHEMLAHVPMFLHPNPKKVLIIGGGDGGTLREVLKHDSVEKAILCEVD
GLVIEAARKYLKQTSCGFDDPRAEIVIANGAEYVRKFKNEFDVIIIDSTDPTAGQGGHLF
TEEFYQACYDALKEDGVFSAETEDPFYDIGWFKLAYRRISKVFPITRVYLGFMTTYPSGM
WSYTFASKGIDPIKDFDPEKVRKFNKELKYYNEEVHVASFALPNFVKKELGLM

>1jq3-a1-m1-cD (length=293) [Search sequence]

Structure information

PDB ID	1jq3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Spermidine Synthase in Complex with Transition State Analogue AdoDATO
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	97
Sequence identity between the two chains	1.0
PubMed citation	11731804

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q9WZC2	Q9WZC2
Species	2336 (Thermotoga maritima)	2336 (Thermotoga maritima)
Function annotation	BioLiP:1jq3C	BioLiP:1jq3D

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1jq3-a1-m1-cC_1jq3-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1jq3-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1inl/1/1:A/1:B 1inl/1/1:D/1:C 1jq3/1/1:B/1:A
Other dimers with similar sequences but different poses	1inl/1/1:D/1:A 1inl/1/1:B/1:C 1jq3/1/1:B/1:C 1jq3/1/1:D/1:A