1jra/1/1:A/1:B

Sequences
>1jra-a1-m1-cA (length=106) [Search sequence]
DDKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIE
KYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYDCATILEDYDCGCS
>1jra-a1-m1-cB (length=106) [Search sequence]
DDKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIE
KYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYDCATILEDYDCGCS
Structure information
PDB ID 1jra (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Erv2p
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 82
Sequence identity between the two chains 1.0
PubMed citation 11740506
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q12284 Q12284
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
Function annotation BioLiP:1jraA BioLiP:1jraB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1jra-a1-m1-cA_1jra-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1jra-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1jr8/1/1:A/1:B 1jra/2/1:D/1:C

[Back to Home]