1jy2/1/1:P/1:S

Sequences
>1jy2-a1-m1-cP (length=44) [Search sequence]
RDNCCILDERFGSYCPTTCGIADFLNNYQTSVDKDLRTLEGILY
>1jy2-a1-m1-cS (length=47) [Search sequence]
VATRDNCCILDERFGSYCPTTCGIADFLNNYQTSVDKDLRTLEGILY
Structure information
PDB ID 1jy2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the Central Region of Bovine Fibrinogen (E5 fragment) at 1.4 Angstroms Resolution
Assembly ID 1
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 55
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID P S
UniProt accession P12799 P12799
Species 9913 (Bos taurus) 9913 (Bos taurus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1jy2-a1-m1-cP_1jy2-a1-m1-cS.pdb.gz
Full biological assembly
Download: 1jy2-assembly1.cif.gz
Similar dimers

[Back to Home]