1jym/1/1:A/1:B

Sequences
>1jym-a1-m1-cA (length=176) [Search sequence]
DEIKIVKYPDPILRRRSEVTNFDDNLKRVVRKFDIYESKGIGLSAPQVNISKRIIVWNAL
YEKRKEENERIFINPSIVEQSLVKLKLIEGCLSFGIEGKVERPSIVSISYYDINGYKHLK
ILKGIHSRIFQHEFDHLNGTLFIDKTQVDKKKVRPKLNELIRDYKATHSEEPLEHH
>1jym-a1-m1-cB (length=176) [Search sequence]
DEIKIVKYPDPILRRRSEVTNFDDNLKRVVRKFDIYESKGIGLSAPQVNISKRIIVWNAL
YEKRKEENERIFINPSIVEQSLVKLKLIEGCLSFGIEGKVERPSIVSISYYDINGYKHLK
ILKGIHSRIFQHEFDHLNGTLFIDKTQVDKKKVRPKLNELIRDYKATHSEEPLEHH
Structure information
PDB ID 1jym (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystals of Peptide Deformylase from Plasmodium falciparum with Ten Subunits per Asymmetric Unit Reveal Critical Characteristics of the Active Site for Drug Design
Assembly ID 1
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation 12005434
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q8I372 Q8I372
Species 5833 (Plasmodium falciparum) 5833 (Plasmodium falciparum)
Function annotation BioLiP:1jymA BioLiP:1jymB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1jym-a1-m1-cA_1jym-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1jym-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1jym/1/1:C/1:D 1jym/1/1:F/1:H 1jym/1/1:G/1:I 1jym/1/1:J/1:E
Other dimers with similar sequences but different poses
  • 1jym/1/1:D/1:A 1jym/1/1:D/1:E 1jym/1/1:I/1:H 1jym/1/1:I/1:J
    		•

    [Back to Home]