1kf6/3/1:D/1:P

Sequences
>1kf6-a3-m1-cD (length=119) [Search sequence]
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ
SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
>1kf6-a3-m1-cP (length=119) [Search sequence]
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ
SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
Structure information
PDB ID 1kf6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO
Assembly ID 3
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
PubMed citation 11850430
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D P
UniProt accession P0A8Q3 P0A8Q3
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:1kf6D BioLiP:1kf6P
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1kf6-a3-m1-cD_1kf6-a3-m1-cP.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1kf6-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1kfy/3/1:D/1:P 1l0v/3/1:D/1:P

[Back to Home]