1kr4/1/2:A/3:A

Sequences
>1kr4-a1-m2-cA (length=107) [Search sequence]
ALYFGHILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIF
KTTEEKEKELYEELRKLHPYETPAIFTLKVENILTEYNWLRESVLGS
>1kr4-a1-m3-cA (length=107) [Search sequence]
ALYFGHILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIF
KTTEEKEKELYEELRKLHPYETPAIFTLKVENILTEYNWLRESVLGS
Structure information
PDB ID 1kr4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure Genomics, Protein TM1056, cutA
Assembly ID 1
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 79
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession Q9X0E6 Q9X0E6
Species 2336 (Thermotoga maritima) 2336 (Thermotoga maritima)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1kr4-a1-m2-cA_1kr4-a1-m3-cA.pdb.gz
Full biological assembly
Download: 1kr4-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1kr4/1/1:A/2:A 1kr4/1/1:A/3:A 1o5j/1/1:A/2:A 1o5j/1/1:A/3:A 1o5j/1/2:A/3:A 1vhf/2/1:A/2:A 1vhf/2/1:A/3:A 1vhf/2/2:A/3:A

[Back to Home]