1l1s/1/2:A/3:A

Sequences
>1l1s-a1-m2-cA (length=108) [Search sequence]
DYRVVFHIDEDDESRVLLLISNVRNLADLESVRIEVVAYSGVNVLRRDSEYSGDVSELTG
QGVRFCACSNTLRASGDGDDLLEGVDVVSSGVGHIVRRQTEGWAYIRP
>1l1s-a1-m3-cA (length=108) [Search sequence]
DYRVVFHIDEDDESRVLLLISNVRNLADLESVRIEVVAYSGVNVLRRDSEYSGDVSELTG
QGVRFCACSNTLRASGDGDDLLEGVDVVSSGVGHIVRRQTEGWAYIRP
Structure information
PDB ID 1l1s (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Protein of Unknown Function MTH1491 from Methanobacterium thermoautotrophicum
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 43
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession O27535 O27535
Species 145262 (Methanothermobacter thermautotrophicus) 145262 (Methanothermobacter thermautotrophicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1l1s-a1-m2-cA_1l1s-a1-m3-cA.pdb.gz
Full biological assembly
Download: 1l1s-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1l1s/1/1:A/2:A 1l1s/1/1:A/3:A

[Back to Home]