1l5e/1/1:A/1:B

Sequences
>1l5e-a1-m1-cA (length=101) [Search sequence]
LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRN
TQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE
>1l5e-a1-m1-cB (length=101) [Search sequence]
LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRN
TQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE
Structure information
PDB ID 1l5e (database links: RCSB PDB PDBe PDBj PDBsum)
Title The domain-swapped dimer of CV-N in solution
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 264
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P81180 P81180
Species 45916 (Nostoc ellipsosporum) 45916 (Nostoc ellipsosporum)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1l5e-a1-m1-cA_1l5e-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1l5e-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3gxy/1/1:A/1:B 1l5b/1/1:A/1:B 3gxz/1/1:A/1:B
  • 3ezm/2/1:A/2:A 1lom/1/1:A/2:A 4j4c/1/1:A/2:A
  • 6x7h/1/1:A/1:B 2pys/1/1:A/1:B 2z21/1/1:A/1:B
  • 4j4f/1/1:A/1:B 4j4d/1/1:A/1:B 4j4d/2/1:C/1:D 4j4e/1/1:A/1:B 4j4e/2/1:D/1:E 4j4f/1/1:C/1:D
  • 4j4e/2/1:D/1:F 4j4e/1/1:A/1:C
  • 4j4e/2/1:E/1:F 4j4e/1/1:B/1:C
  • 4j4f/1/1:B/1:D 4j4f/1/1:A/1:C
  • 4j4g/1/1:B/1:D 4j4g/1/1:A/1:C
  • 4j4g/1/1:A/1:D 4j4g/1/1:B/1:C
  • [Back to Home]