1ldk/2/1:E/2:E

Sequences
>1ldk-a2-m1-cE (length=41) [Search sequence]
WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW
>1ldk-a2-m2-cE (length=41) [Search sequence]
WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW
Structure information
PDB ID 1ldk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex
Assembly ID 2
Resolution 3.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID E E
UniProt accession Q13309 Q13309
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1ldk-a2-m1-cE_1ldk-a2-m2-cE.pdb.gz
Full biological assembly
Download: 1ldk-assembly2.cif.gz

[Back to Home]