1lgp/1/1:A/2:A

Sequences
>1lgp-a1-m1-cA (length=113) [Search sequence]
MQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQV
TLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLYESLSE
>1lgp-a1-m2-cA (length=113) [Search sequence]
MQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQV
TLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLYESLSE
Structure information
PDB ID 1lgp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the FHA domain of the Chfr mitotic checkpoint protein complexed with tungstate
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 237
Sequence identity between the two chains 1.0
PubMed citation 12121644
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q96EP1 Q96EP1
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1lgpA BioLiP:1lgpA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1lgp-a1-m1-cA_1lgp-a1-m2-cA.pdb.gz
Full biological assembly
Download: 1lgp-assembly1.cif.gz
Similar dimers

[Back to Home]