1lgp/1/1:A/2:A

Sequences

>1lgp-a1-m1-cA (length=113) [Search sequence]

MQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQV TLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLYESLSE

>1lgp-a1-m2-cA (length=113) [Search sequence]

MQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQV TLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLYESLSE

Structure information

PDB ID	1lgp (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the FHA domain of the Chfr mitotic checkpoint protein complexed with tungstate
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	237
Sequence identity between the two chains	1.0
PubMed citation	12121644

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession	Q96EP1	Q96EP1
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:1lgpA	BioLiP:1lgpA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1lgp-a1-m1-cA_1lgp-a1-m2-cA.pdb.gz

Full biological assembly Download: 1lgp-assembly1.cif.gz

Similar dimers