1lj0/1/1:A/1:B

Sequences
>1lj0-a1-m1-cA (length=89) [Search sequence]
GSDPAVTYYRLEEVAKRNTSEETWMVLHGRVYDLTRFLSEHPGGEEVLREQAGADATESF
EDVGHSPDAREMSKQYYIGDVHPNDLKPK
>1lj0-a1-m1-cB (length=89) [Search sequence]
GSDPAVTYYRLEEVAKRNTSEETWMVLHGRVYDLTRFLSEHPGGEEVLREQAGADATESF
EDVGHSPDAREMSKQYYIGDVHPNDLKPK
Structure information
PDB ID 1lj0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of quintuple mutant of the rat outer mitocondrial cytochrome b5.
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation 12269800
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P04166 P04166
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
Function annotation BioLiP:1lj0A BioLiP:1lj0B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1lj0-a1-m1-cA_1lj0-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1lj0-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1awp/1/1:A/1:B 1lj0/3/1:D/1:C
Other dimers with similar sequences but different poses
  • 1icc/5/2:C/1:B 1lj0/5/2:C/1:B 2i89/5/2:C/1:B
  • [Back to Home]