1lj0/2/1:C/1:B

Sequences

>1lj0-a2-m1-cC (length=88) [Search sequence]

GSDPAVTYYRLEEVAKRNTSEETWMVLHGRVYDLTRFLSEHPGGEEVLREQAGADATESF EDVGHSPDAREMSKQYYIGDVHPNDLKP

>1lj0-a2-m1-cB (length=89) [Search sequence]

GSDPAVTYYRLEEVAKRNTSEETWMVLHGRVYDLTRFLSEHPGGEEVLREQAGADATESF EDVGHSPDAREMSKQYYIGDVHPNDLKPK

Structure information

PDB ID	1lj0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of quintuple mutant of the rat outer mitocondrial cytochrome b5.
Assembly ID	2
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	11
Sequence identity between the two chains	1.0
PubMed citation	12269800

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	P04166	P04166
Species	10116 (Rattus norvegicus)	10116 (Rattus norvegicus)
Function annotation	BioLiP:1lj0C	BioLiP:1lj0B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1lj0-a2-m1-cC_1lj0-a2-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1lj0-assembly2.cif.gz