1lj2/1/1:A/1:B

Sequences

>1lj2-a1-m1-cA (length=106) [Search sequence]

HSLQNVIPQQQAHIAELQVYNNKLERDLQNKIGSLTSSIEWYLRSMELDPEIKADIEQQI NSIDAINPLHAFDDLESVIRNLISDYDKLFLMFKGLIQRSNYQYSF

>1lj2-a1-m1-cB (length=110) [Search sequence]

MHSLQNVIPQQQAHIAELQVYNNKLERDLQNKIGSLTSSIEWYLRSMELDPEIKADIEQQ INSIDAINPLHAFDDLESVIRNLISDYDKLFLMFKGLIQRSNYQYSFGSE

Structure information

PDB ID	1lj2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Recognition of eIF4G by Rotavirus NSP3 reveals a basis for mRNA circularization
Assembly ID	1
Resolution	2.38Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	149
Sequence identity between the two chains	1.0
PubMed citation	12086624

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P03536	P03536
Species	10923 (Simian rotavirus A/SA11)	10923 (Simian rotavirus A/SA11)
Function annotation	BioLiP:1lj2A	BioLiP:1lj2B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1lj2-a1-m1-cA_1lj2-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1lj2-assembly1.cif.gz