1ljm/3/2:A/2:B

Sequences

>1ljm-a3-m2-cA (length=114) [Search sequence]

ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPR

>1ljm-a3-m2-cB (length=114) [Search sequence]

GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRN ATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGP

Structure information

PDB ID	1ljm (database links: RCSB PDB PDBe PDBj PDBsum)
Title	DNA recognition is mediated by conformational transition and by DNA bending
Assembly ID	3
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	42
Sequence identity between the two chains	0.991

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	Q01196	Q01196
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1ljm-a3-m2-cA_1ljm-a3-m2-cB.pdb.gz

Full biological assembly Download: 1ljm-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

1ljm/3/1:A/2:B 1ljm/3/1:B/2:A 1ljm/4/1:B/2:B 1ljm/3/1:B/2:B