1llm/1/1:D/1:C

Sequences

>1llm-a1-m1-cD (length=85) [Search sequence]

MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHRDIQHILPIL EDKVEELLSKNYHLENEVARLKKLV

>1llm-a1-m1-cC (length=87) [Search sequence]

MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHRDIQHILPIL EDKVEELLSKNYHLENEVARLKKLVGE

Structure information

PDB ID	1llm (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of a Zif23-GCN4 Chimera Bound to DNA
Assembly ID	1
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	59
Sequence identity between the two chains	1.0
PubMed citation	14621985

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	P03069	P03069
Species	559292 (Saccharomyces cerevisiae S288C)	559292 (Saccharomyces cerevisiae S288C)
Function annotation	BioLiP:1llmD	BioLiP:1llmC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1llm-a1-m1-cD_1llm-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1llm-assembly1.cif.gz