1m2d/1/1:A/1:B

Sequences
>1m2d-a1-m1-cA (length=101) [Search sequence]
FKHVFVCVQDRPPGHPQGSCAQRGSREVFQAFMEKIQTDPQLFMTTVITPTGCMNASMMG
PVVVVYPDGVWYGQVKPEDVDEIVEKHLKGGEPVERLVISK
>1m2d-a1-m1-cB (length=101) [Search sequence]
FKHVFVCVQDRPPGHPQGSCAQRGSREVFQAFMEKIQTDPQLFMTTVITPTGCMNASMMG
PVVVVYPDGVWYGQVKPEDVDEIVEKHLKGGEPVERLVISK
Structure information
PDB ID 1m2d (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure at 1.05 Angstroms resolution of the Cys59Ser variant of the thioredoxin-like [2Fe-2S] ferredoxin from Aquifex aeolicus
Assembly ID 1
Resolution 1.05Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 38
Sequence identity between the two chains 1.0
PubMed citation 12089152
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession O66511 O66511
Species 63363 (Aquifex aeolicus) 63363 (Aquifex aeolicus)
Function annotation BioLiP:1m2dA BioLiP:1m2dB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1m2d-a1-m1-cA_1m2d-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1m2d-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1f37/1/1:A/1:B 1f37/2/1:A/1:B 1f37/2/2:A/2:B 1m2a/1/1:B/1:A 1m2b/1/1:A/1:B

[Back to Home]