1mn3/2/1:A/2:A

Sequences
>1mn3-a2-m1-cA (length=52) [Search sequence]
SSLIKKIEENERKDTLNTLQNFPDDPSLIEDVCIAKKSRIEPCVDALLSLSE
>1mn3-a2-m2-cA (length=52) [Search sequence]
SSLIKKIEENERKDTLNTLQNFPDDPSLIEDVCIAKKSRIEPCVDALLSLSE
Structure information
PDB ID 1mn3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Cue domain of yeast Vps9p
Assembly ID 2
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P54787 P54787
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1mn3-a2-m1-cA_1mn3-a2-m2-cA.pdb.gz
Full biological assembly
Download: 1mn3-assembly2.cif.gz

[Back to Home]