1mpe/1/1:B/1:D

Sequences
>1mpe-a1-m1-cB (length=56) [Search sequence]
MQYKVILNGKTLKGETTTEAVDAATFEKVVKQFFNDNGVDGEWTYDDATKTFTVTE
>1mpe-a1-m1-cD (length=56) [Search sequence]
MQYKVILNGKTLKGETTTEAVDAATFEKVVKQFFNDNGVDGEWTYDDATKTFTVTE
Structure information
PDB ID 1mpe (database links: RCSB PDB PDBe PDBj PDBsum)
Title Ensemble of 20 structures of the tetrameric mutant of the B1 domain of streptococcal protein G
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 68
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession P06654 P06654
Species 1320 (Streptococcus sp. 'group G') 1320 (Streptococcus sp. 'group G')
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1mpe-a1-m1-cB_1mpe-a1-m1-cD.pdb.gz
Full biological assembly
Download: 1mpe-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1mpe/1/1:C/1:D 1mpe/1/1:A/1:B
  • 1mpe/1/1:A/1:D 1mpe/1/1:B/1:C
  • 3fil/1/1:A/1:B 2klk/1/1:A/1:B 2rmm/1/1:A/1:B 6nl8/1/1:A/2:A
  • 2kwd/1/1:A/1:C 2kwd/1/1:A/1:B
  • 2kwd/1/1:A/1:E 2kwd/1/1:A/1:D
  • 3v3x/2/1:B/1:D 3v3x/1/1:A/1:C
    		•

    [Back to Home]