1mt9/1/1:A/1:B

Sequences
>1mt9-a1-m1-cA (length=99) [Search sequence]
PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>1mt9-a1-m1-cB (length=99) [Search sequence]
PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
Structure information
PDB ID 1mt9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Viability of a drug-resistant HIV-1 protease mutant: structural insights for better antiviral therapy
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 144
Sequence identity between the two chains 1.0
PubMed citation 12502847
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P03369 P03369
Species 11676 (Human immunodeficiency virus 1) 11676 (Human immunodeficiency virus 1)
Function annotation BioLiP:1mt9A BioLiP:1mt9B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1mt9-a1-m1-cA_1mt9-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1mt9-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1f7a/1/1:A/1:B 1k6t/1/1:B/1:A 1kj7/1/1:A/1:B 1kjg/1/1:A/1:B 1kjh/1/1:A/1:B 1mt7/1/1:A/1:B 1mt8/1/1:A/1:B 1mtb/1/1:A/1:B 1n49/1/1:A/1:B 1n49/2/1:C/1:D 1tsq/1/1:A/1:B 2azb/1/1:A/2:A 2azc/1/1:A/1:B 2azc/2/1:A/1:B 2azc/2/2:A/2:B 2fgu/1/1:A/1:B 2fnt/1/1:A/1:B 2hb2/1/1:A/2:A 2hc0/1/1:A/1:B 3ekp/1/1:A/1:B 3ekp/2/1:C/1:D 3ekq/1/1:A/1:B 3ekt/1/1:A/1:B 3ekt/2/1:C/1:D 3ekw/1/1:A/1:B 3el0/1/1:A/1:B 3el9/1/1:A/1:B 3em4/1/1:A/1:B 3em4/2/1:U/1:V 3em6/1/1:A/1:B 3lzs/1/1:A/1:B 3oxw/1/1:A/1:B 3oxw/2/1:C/1:D 3oxx/1/1:A/1:B 3oxx/2/1:C/1:D 4qj2/1/1:A/1:B 4qj2/2/1:C/1:D 4qj6/1/1:A/1:B 4qj6/2/1:C/1:D 4qj7/1/1:A/1:B 4qj7/2/1:C/1:D 4qj8/1/1:A/1:B 4qj8/2/1:C/1:D 7mar/1/1:C/1:D 7mar/2/1:A/1:B 7mas/1/1:A/1:B 7mas/2/1:C/1:D
Other dimers with similar sequences but different poses
  • 2azc/2/1:A/2:B 2azc/2/1:B/2:A
  • [Back to Home]