1n47/1/1:A/1:D

Sequences

>1n47-a1-m1-cA (length=233) [Search sequence]

TESTSFSFTNFNPNQNNLILQEDALVNSAGTLELTAVAAGAPVPDSLGRALYAAPIHIHD
NTTLASFTTSFSFVMAAPAAAAVADGLAFFLAPPDTQPQARGGFLGLFADRAHDASYQTV
AVEFDTYSNAWDPNYTHIGIDTNGIESKKTTPFDMVYGEKANIVITYQASTKALAASLVF
PVSQTSYAVSARVDLRDILPEYVRVGFSATTGLNAGVVETHDIVSWSFAVSLA

>1n47-a1-m1-cD (length=233) [Search sequence]

Structure information

PDB ID	1n47 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Isolectin B4 from Vicia villosa in complex with the Tn antigen
Assembly ID	1
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	67
Sequence identity between the two chains	1.0
PubMed citation	12586347

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	P56625	P56625
Species	3911 (Vicia villosa)	3911 (Vicia villosa)
Function annotation	BioLiP:1n47A	BioLiP:1n47D

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1n47-a1-m1-cA_1n47-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1n47-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

1n47/1/1:C/1:D 1n47/1/1:A/1:B