1n5s/1/1:A/1:B

Sequences

>1n5s-a1-m1-cA (length=112) [Search sequence]

AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAVV NYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS

>1n5s-a1-m1-cB (length=112) [Search sequence]

AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAVV NYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS

Structure information

PDB ID	1n5s (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a Monooxygenase from the gene ActVA-Orf6 of Streptomyces coelicolor in complex with the ligand Acetyl Dithranol
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	136
Sequence identity between the two chains	1.0
PubMed citation	12514126

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q53908	Q53908
Species	100226 (Streptomyces coelicolor A3(2))	100226 (Streptomyces coelicolor A3(2))
Function annotation	BioLiP:1n5sB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1n5s-a1-m1-cA_1n5s-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1n5s-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1lq9/1/1:A/1:B 1n5q/1/1:A/1:B 1n5t/1/1:A/1:B 1n5v/1/1:A/1:B