1n9l/3/1:A/3:A

Sequences

>1n9l-a3-m1-cA (length=109) [Search sequence]

GLRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDA IKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS

>1n9l-a3-m3-cA (length=109) [Search sequence]

GLRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDA IKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS

Structure information

PDB ID	1n9l (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Phot-LOV1 domain from Chlamydomonas reinhardtii in the dark state.
Assembly ID	3
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	60
Sequence identity between the two chains	1.0
PubMed citation	12668455

Chain information

	Chain 1	Chain 2
Model ID	1	3
Chain ID	A	A
UniProt accession	Q8LPD9	Q8LPD9
Species	3055 (Chlamydomonas reinhardtii)	3055 (Chlamydomonas reinhardtii)
Function annotation	BioLiP:1n9lA	BioLiP:1n9lA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1n9l-a3-m1-cA_1n9l-a3-m3-cA.pdb.gz

Full biological assembly Download: 1n9l-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

1n9l/2/1:A/2:A 1n9o/2/1:A/2:A