1naq/3/1:C/1:F

Sequences
>1naq-a3-m1-cC (length=105) [Search sequence]
NTASVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYEVQMILK
TTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
>1naq-a3-m1-cF (length=105) [Search sequence]
NTASVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYEVQMILK
TTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
Structure information
PDB ID 1naq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of CUTA1 from E.coli at 1.7 A resolution
Assembly ID 3
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C F
UniProt accession P69488 P69488
Species 562 (Escherichia coli) 562 (Escherichia coli)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1naq-a3-m1-cC_1naq-a3-m1-cF.pdb.gz
Full biological assembly
Download: 1naq-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1naq/3/1:B/1:D 1naq/3/1:E/1:A
Other dimers with similar sequences but different poses
  • 3x3u/1/1:A/1:C 1naq/1/1:B/1:A 1naq/1/1:B/1:C 1naq/1/1:C/1:A 1naq/2/1:D/1:E 1naq/2/1:D/1:F 1naq/2/1:E/1:F 1naq/3/1:B/1:A 1naq/3/1:B/1:C 1naq/3/1:C/1:A 1naq/3/1:D/1:E 1naq/3/1:D/1:F 1naq/3/1:E/1:F 3aa8/1/1:A/1:B 3aa8/1/1:A/1:C 3aa8/1/1:C/1:B 3aa9/1/1:A/1:C 3aa9/1/1:B/1:A 3aa9/1/1:B/1:C 3ah6/1/1:A/1:B 3ah6/1/1:A/1:C 3ah6/1/1:B/1:C 3ah6/2/1:E/1:D 3ah6/2/1:E/1:F 3ah6/2/1:F/1:D 3opk/1/1:A/1:B 3opk/1/1:A/1:C 3opk/1/1:B/1:C 3x3u/1/1:A/1:B 3x3u/1/1:B/1:C 3x3u/2/1:D/1:F 3x3u/2/1:E/1:D 3x3u/2/1:E/1:F 4y6i/1/1:A/1:B 4y6i/1/1:A/1:C 4y6i/2/1:D/1:E 4y6i/2/1:D/1:F 4y6i/2/1:E/1:F
  • 1naq/3/1:F/1:A 1naq/3/1:B/1:E 1naq/3/1:D/1:C
  • [Back to Home]