1nei/1/1:A/1:B

Sequences
>1nei-a1-m1-cA (length=60) [Search sequence]
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW
>1nei-a1-m1-cB (length=60) [Search sequence]
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW
Structure information
PDB ID 1nei (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution NMR Structure of Protein yoaG from Escherichia coli. Ontario Centre for Structural Proteomics Target EC0264_1_60; Northeast Structural Genomics Consortium Target ET94.
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 104
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P64496 P64496
Species 562 (Escherichia coli) 562 (Escherichia coli)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1nei-a1-m1-cA_1nei-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1nei-assembly1.cif.gz

[Back to Home]