1nek/2/2:D/3:D

Sequences

>1nek-a2-m2-cD (length=113) [Search sequence]

SNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTL LALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV

>1nek-a2-m3-cD (length=113) [Search sequence]

SNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTL LALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV

Structure information

PDB ID	1nek (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Complex II (Succinate Dehydrogenase) From E. Coli with ubiquinone bound
Assembly ID	2
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	39
Sequence identity between the two chains	1.0
PubMed citation	12560550

Chain information

	Chain 1	Chain 2
Model ID	2	3
Chain ID	D	D
UniProt accession	P0AC44	P0AC44
Species	562 (Escherichia coli)	562 (Escherichia coli)
Function annotation	BioLiP:1nekD	BioLiP:1nekD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1nek-a2-m2-cD_1nek-a2-m3-cD.pdb.gz

Full biological assembly Download: 1nek-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1nek/2/1:D/2:D 1nek/2/1:D/3:D 1nen/2/1:D/2:D 1nen/2/1:D/3:D 1nen/2/2:D/3:D 2acz/1/1:D/2:D 2acz/1/1:D/3:D 2acz/1/2:D/3:D 6wu6/1/1:D/1:H 6wu6/1/1:D/1:L 6wu6/1/1:H/1:L 7jz2/1/1:D/1:H 7jz2/1/1:D/1:L 7jz2/1/1:H/1:L