1ng7/1/1:A/1:B

Sequences
>1ng7-a1-m1-cA (length=60) [Search sequence]
MGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCEKKGWIVNITSQVQTERNINRA
>1ng7-a1-m1-cB (length=60) [Search sequence]
MGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCEKKGWIVNITSQVQTERNINRA
Structure information
PDB ID 1ng7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Solution Structure of the Soluble Domain of Poliovirus 3A Protein
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 45
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P03300 P03300
Species 12080 (Poliovirus 1) 12080 (Poliovirus 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1ng7-a1-m1-cA_1ng7-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1ng7-assembly1.cif.gz

[Back to Home]