1nju/3/1:A/1:D

Sequences

>1nju-a3-m1-cA (length=230) [Search sequence]

DEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQLSVALPLNINHDDTAVV
GHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRGPVSPLQPDKVVEFLSGSYA
GLSLSSRRCDDVEQTTPFKHVALCSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRA
QWQSGDPFRSDSYGLLGNSVDALYIRERLPKLRYDKQLVGVTERESYVKA

>1nju-a3-m1-cD (length=230) [Search sequence]

Structure information

PDB ID	1nju (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Complex structure of HCMV Protease and a peptidomimetic inhibitor
Assembly ID	3
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	28
Sequence identity between the two chains	1.0
PubMed citation	12549906

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	P16753	P16753
Species	10359 (Human betaherpesvirus 5)	10359 (Human betaherpesvirus 5)
Function annotation	BioLiP:1njuA	BioLiP:1njuD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1nju-a3-m1-cA_1nju-a3-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1nju-assembly3.cif.gz