1nlq/1/1:C/1:E

Sequences

>1nlq-a1-m1-cC (length=96) [Search sequence]

ESFYGVTLTAESDSVTWDVGQKLVIKQILLGAEAKENEFNVVEVNTPKDSVQIPIAVLKA GETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNIK

>1nlq-a1-m1-cE (length=98) [Search sequence]

ESFYGVTLTAESDSVTWDVARGQKLVIKQILLGAEAKENEFNVVEVNTPKDSVQIPIAVL KAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNIK

Structure information

PDB ID	1nlq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of Drosophila NLP-core provides insight into pentamer formation and histone binding
Assembly ID	1
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	68
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	E
UniProt accession	Q27415	Q27415
Species	7227 (Drosophila melanogaster)	7227 (Drosophila melanogaster)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1nlq-a1-m1-cC_1nlq-a1-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1nlq-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1nlq/1/1:B/1:A 1nlq/1/1:D/1:B 1nlq/1/1:D/1:C 1nlq/1/1:E/1:A