1nr4/5/4:G/3:E

Sequences
>1nr4-a5-m4-cG (length=66) [Search sequence]
GTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAV
KYLQSL
>1nr4-a5-m3-cE (length=69) [Search sequence]
GTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAV
KYLQSLERS
Structure information
PDB ID 1nr4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title High resolution crystal structures of thymus and activation-regulated chemokine
Assembly ID 5
Resolution 1.72Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 3
Chain ID G E
UniProt accession Q92583 Q92583
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1nr4-a5-m4-cG_1nr4-a5-m3-cE.pdb.gz
Full biological assembly
Download: 1nr4-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1nr4/5/3:F/3:E 1nr4/2/1:D/1:C 1nr4/3/1:F/1:E 1nr4/5/2:D/2:C
  • [Back to Home]