1nxt/1/1:A/2:A

Sequences
>1nxt-a1-m1-cA (length=115) [Search sequence]
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILLMLPDGLEVA
KTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS
>1nxt-a1-m2-cA (length=115) [Search sequence]
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILLMLPDGLEVA
KTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS
Structure information
PDB ID 1nxt (database links: RCSB PDB PDBe PDBj PDBsum)
Title MicArec pH 4.0
Assembly ID 1
Resolution 2.34Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation 15090529
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession A0A0H2UQ68 A0A0H2UQ68
Species 170187 (Streptococcus pneumoniae TIGR4) 170187 (Streptococcus pneumoniae TIGR4)
Function annotation BioLiP:1nxtA BioLiP:1nxtA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1nxt-a1-m1-cA_1nxt-a1-m2-cA.pdb.gz
Full biological assembly
Download: 1nxt-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1nxo/1/1:A/2:A 1nxp/1/1:A/2:A 1nxx/1/1:A/2:A 2a9r/1/1:A/2:A
Other dimers with similar sequences but different poses
  • 1nxw/1/1:A/2:A 1nxs/1/1:A/2:A
  • [Back to Home]