1o5i/1/1:B/1:D

Sequences

>1o5i-a1-m1-cB (length=234) [Search sequence]

GIRDKGVLVLAASRGIGRAVADVLSQEGAEVTICARNEELLKRSGHRYVVCDLRKDLDLL
FEKVKEVDILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGWGRI
VAITSFSVISPIENLYTSNSARMALTGFLKTLSFEVAPYGITVNCVAPGWTETERVKELL
SEEKKKQVESQIPMRRMAKPEEIASVVAFLCSEKASYLTGQTIVVDGGLSKFPL

>1o5i-a1-m1-cD (length=234) [Search sequence]

Structure information

PDB ID	1o5i (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of 3-oxoacyl-(acyl carrier protein) reductase (TM1169) from Thermotoga maritima at 2.50 A resolution
Assembly ID	1
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	26
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	Q9X0Q1	Q9X0Q1
Species	2336 (Thermotoga maritima)	2336 (Thermotoga maritima)
Function annotation	BioLiP:1o5iB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1o5i-a1-m1-cB_1o5i-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1o5i-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

1o5i/1/1:C/1:D 1o5i/1/1:A/1:B

1o5i/1/1:A/1:D 1o5i/1/1:B/1:C