1o7k/1/1:B/1:C

Sequences

>1o7k-a1-m1-cB (length=117) [Search sequence]

TFIRHIALLGFEKRFVPSQHYVYFLVKWQDLSEKVVYRRFTEIYEFHKTLKEFPIEAGAI NPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLSLPTKISRCPHLLDFFKVRPD

>1o7k-a1-m1-cC (length=117) [Search sequence]

TFIRHIALLGFEKRFVPSQHYVYFLVKWQDLSEKVVYRRFTEIYEFHKTLKEFPIEAGAI NPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLSLPTKISRCPHLLDFFKVRPD

Structure information

PDB ID	1o7k (database links: RCSB PDB PDBe PDBj PDBsum)
Title	human p47 PX domain complex with sulphates
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	30
Sequence identity between the two chains	1.0
PubMed citation	12356722

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	P14598	P14598
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:1o7kB	BioLiP:1o7kC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1o7k-a1-m1-cB_1o7k-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1o7k-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1o7k/1/1:B/1:A 1o7k/1/1:C/1:A