1oi6/1/1:A/1:B

Sequences

>1oi6-a1-m1-cA (length=202) [Search sequence]

MQARKLAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMSKRGVVR
GIHYTVTPPGTAKYVYCARGKAMDIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGH
AFVALEDDTVMSYMLSRSYVTQDELALSALDPALGLPIDIGVEPIVSDRDRVAITLAEAQ
RQGLLPDYTTSQEIERRLTAVP

>1oi6-a1-m1-cB (length=202) [Search sequence]

Structure information

PDB ID	1oi6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure determination of the TMP-complex of EvaD
Assembly ID	1
Resolution	1.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	111
Sequence identity between the two chains	1.0
PubMed citation	15159413

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O52806	O52806
Species	31958 (Amycolatopsis orientalis)	31958 (Amycolatopsis orientalis)
Function annotation	BioLiP:1oi6A	BioLiP:1oi6B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1oi6-a1-m1-cA_1oi6-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1oi6-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1ofn/1/1:A/1:B 1wa4/1/1:A/2:A