1os9/10/1:C/3:E

Sequences
>1os9-a10-m1-cC (length=165) [Search sequence]
MMGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVF
ARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHS
LGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKEN
>1os9-a10-m3-cE (length=165) [Search sequence]
MMGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVF
ARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHS
LGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKEN
Structure information
PDB ID 1os9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Binary enzyme-product complexes of human MMP12
Assembly ID 10
Resolution 1.85Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 38
Sequence identity between the two chains 1.0
PubMed citation 12813751
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID C E
UniProt accession P39900 P39900
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1os9C BioLiP:1os9E
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1os9-a10-m1-cC_1os9-a10-m3-cE.pdb.gz
Full biological assembly
Download: 1os9-assembly10.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1os2/9/1:A/2:C 1os9/9/1:D/2:F
Other dimers with similar sequences but different poses
  • 1os9/8/1:A/1:C 1os2/7/1:D/1:E 1os2/7/1:E/1:F 1os2/8/1:A/1:B 1os2/8/1:B/1:C 1os9/7/1:B/1:D 1os9/7/1:B/1:F 1os9/8/1:A/1:E
  • 1utt/1/5:A/6:A 1utt/1/1:A/2:A 1utt/1/1:A/3:A 1utt/1/2:A/3:A 1utt/1/4:A/5:A 1utt/1/4:A/6:A
  • 1utt/1/3:A/6:A 1utt/1/1:A/4:A 1utt/1/2:A/5:A
  • 1utz/1/3:A/3:B 1utz/1/1:A/1:B 1utz/1/2:A/2:B
  • 1utz/1/2:B/3:B 1utz/1/1:A/2:A 1utz/1/1:A/3:A 1utz/1/1:B/2:B 1utz/1/1:B/3:B 1utz/1/2:A/3:A
  • 4h49/1/1:A/1:B 4h30/1/1:A/1:B 4h49/2/1:C/1:D
    		•

    [Back to Home]