1osc/3/1:B/1:F

Sequences

>1osc-a3-m1-cB (length=109) [Search sequence]

YVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMM IKTQSSLVPALTEFVRSVHPYEVAEVIALPVEQGNPPYLHWVHQVTESV

>1osc-a3-m1-cF (length=111) [Search sequence]

GSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEV LMMIKTQSSLVPALTEFVRSVHPYVAEVIALPVEQGNPPYLHWVHQVTESV

Structure information

PDB ID	1osc (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of rat CUTA1 at 2.15 A resolution
Assembly ID	3
Resolution	2.15Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	10
Sequence identity between the two chains	0.991

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	F
UniProt accession	Q6MGD0	Q6MGD0
Species	10116 (Rattus norvegicus)	10116 (Rattus norvegicus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1osc-a3-m1-cB_1osc-a3-m1-cF.pdb.gz

Full biological assembly Download: 1osc-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1osc/3/1:A/1:E 1osc/3/1:C/1:D

Other dimers with similar sequences but different poses

1xk8/1/1:A/1:C 1osc/1/1:A/1:B 1osc/1/1:A/1:C 1osc/1/1:C/1:B 1osc/2/1:D/1:E 1osc/2/1:D/1:F 1osc/2/1:E/1:F 1osc/3/1:A/1:B 1osc/3/1:A/1:C 1osc/3/1:C/1:B 1osc/3/1:D/1:E 1osc/3/1:D/1:F 1osc/3/1:E/1:F 1xk8/1/1:A/1:B 1xk8/1/1:B/1:C 1xk8/1/1:E/1:D 1xk8/1/1:E/1:F 1xk8/1/1:F/1:D 2zfh/1/1:B/1:A 2zfh/1/1:C/1:A 2zfh/1/1:C/1:B 2zfh/2/1:D/1:E 2zfh/2/1:D/1:F 2zfh/2/1:E/1:F 1xk8/1/1:B/1:F 1osc/3/1:A/1:D 1osc/3/1:B/1:E 1osc/3/1:C/1:F 1xk8/1/1:A/1:D 1xk8/1/1:C/1:E