1ox9/4/1:G/1:H

Sequences

>1ox9-a4-m1-cG (length=108) [Search sequence]

SQLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNL ELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD

>1ox9-a4-m1-cH (length=108) [Search sequence]

SQLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNL ELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD

Structure information

PDB ID	1ox9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of SspB-ssrA complex
Assembly ID	4
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0
PubMed citation	12887894

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	H
UniProt accession	P0AFZ3	P0AFZ3
Species	83334 (Escherichia coli O157:H7)	83334 (Escherichia coli O157:H7)
Function annotation	BioLiP:1ox9G	BioLiP:1ox9H

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1ox9-a4-m1-cG_1ox9-a4-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1ox9-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1ox8/1/1:A/1:B 1ox9/1/1:A/1:B 1ox9/2/1:C/1:D 1ox9/3/1:E/1:F 1yfn/1/1:B/1:A 1yfn/2/1:C/1:D 8et3/1/1:Y/1:Z