1oxn/7/1:A/1:D

Sequences
>1oxn-a7-m1-cA (length=99) [Search sequence]
AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGG
LQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQET
>1oxn-a7-m1-cD (length=100) [Search sequence]
AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGG
LQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETH
Structure information
PDB ID 1oxn (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of Apoptosis (ML-IAP)
Assembly ID 7
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 74
Sequence identity between the two chains 1.0
PubMed citation 12846571
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A D
UniProt accession Q96CA5 Q96CA5
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1oxnA BioLiP:1oxnD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1oxn-a7-m1-cA_1oxn-a7-m1-cD.pdb.gz
Full biological assembly
Download: 1oxn-assembly7.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1oxn/10/1:A/1:D 1oxn/6/1:A/1:D 1oxn/6/1:B/1:C 1oxn/8/1:B/1:C 1oxq/10/1:A/1:D 1oxq/6/1:A/1:D 1oxq/6/1:B/1:C 1oxq/7/1:A/1:D 1oxq/8/1:B/1:C 1oy7/6/1:A/1:D 1oy7/7/1:B/1:C 3f7g/6/1:A/1:D 3f7g/6/1:B/1:C
Other dimers with similar sequences but different poses
  • 1oxn/6/1:D/1:B 1oxn/6/1:A/1:C 1oxq/6/1:A/1:C 1oxq/6/1:D/1:B 3f7g/6/1:A/1:C 3f7g/6/1:D/1:B
  • 1oxq/9/2:E/1:D 1oxn/6/2:E/1:D 1oxn/7/2:E/1:D 1oxn/9/2:E/1:D 1oxq/6/2:E/1:D 1oxq/7/2:E/1:D 1tw6/3/1:A/2:B 2i3h/3/1:A/2:B 2i3h/5/1:A/2:B 2i3h/6/1:A/2:B
  • 2i3h/6/2:A/2:B 1tw6/3/1:A/1:B 1tw6/3/2:A/2:B 2i3h/3/1:A/1:B 2i3h/3/2:A/2:B 2i3h/5/1:A/1:B 2i3h/5/2:A/2:B 2i3h/6/1:A/1:B
  • [Back to Home]