1oxq/9/2:E/1:D

Sequences

>1oxq-a9-m2-cE (length=94) [Search sequence]

GPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRG DDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHS

>1oxq-a9-m1-cD (length=100) [Search sequence]

AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGG LQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETH

Structure information

PDB ID	1oxq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of Apoptosis (ML-IAP)
Assembly ID	9
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	34
Sequence identity between the two chains	0.989
PubMed citation	12846571

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	E	D
UniProt accession	Q96CA5	Q96CA5
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:1oxqE	BioLiP:1oxqD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1oxq-a9-m2-cE_1oxq-a9-m1-cD.pdb.gz

Full biological assembly Download: 1oxq-assembly9.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1oxn/6/2:E/1:D 1oxn/7/2:E/1:D 1oxn/9/2:E/1:D 1oxq/6/2:E/1:D 1oxq/7/2:E/1:D 1tw6/3/1:A/2:B 2i3h/3/1:A/2:B 2i3h/5/1:A/2:B 2i3h/6/1:A/2:B

Other dimers with similar sequences but different poses

1oxn/7/1:A/1:D 1oxn/10/1:A/1:D 1oxn/6/1:A/1:D 1oxn/6/1:B/1:C 1oxn/8/1:B/1:C 1oxq/10/1:A/1:D 1oxq/6/1:A/1:D 1oxq/6/1:B/1:C 1oxq/7/1:A/1:D 1oxq/8/1:B/1:C 1oy7/6/1:A/1:D 1oy7/7/1:B/1:C 3f7g/6/1:A/1:D 3f7g/6/1:B/1:C 1oxn/6/1:D/1:B 1oxn/6/1:A/1:C 1oxq/6/1:A/1:C 1oxq/6/1:D/1:B 3f7g/6/1:A/1:C 3f7g/6/1:D/1:B 2i3h/6/2:A/2:B 1tw6/3/1:A/1:B 1tw6/3/2:A/2:B 2i3h/3/1:A/1:B 2i3h/3/2:A/2:B 2i3h/5/1:A/1:B 2i3h/5/2:A/2:B 2i3h/6/1:A/1:B