1oyp/1/1:E/1:F

Sequences

>1oyp-a1-m1-cE (length=226) [Search sequence]

MRHDGRQHDELRPITFDLDFISHPEGSVLITAGNTKVICNASVEDRVPPFLRGGGKGWIT
AEYSMLSGRTMEIQRLIGRALRAVVDLEKLGERTIWIDCDVIQADGGTRTASITGAFLAM
AIAIGKLIKAGTIKTNPITDFLAAISVGIDKEQGILLDLNYEEDSSAEVDMNVIMTGSGR
FVELQGTGEEATFSREDLNGLLGLAEKGIQELIDKQKEVLGDSLPE

>1oyp-a1-m1-cF (length=226) [Search sequence]

Structure information

PDB ID	1oyp (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis
Assembly ID	1
Resolution	2.76Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	75
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	P28619	P28619
Species	1423 (Bacillus subtilis)	1423 (Bacillus subtilis)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1oyp-a1-m1-cE_1oyp-a1-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1oyp-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1oyp/1/1:A/1:B 1oyp/1/1:C/1:D 1oyr/1/1:A/1:B 1oyr/1/1:C/1:D 1oyr/1/1:E/1:F 1oys/1/1:A/2:A
Other dimers with similar sequences but different poses	1oyp/1/1:B/1:C 1oyp/1/1:A/1:F 1oyp/1/1:D/1:E 1oyr/1/1:A/1:F 1oyr/1/1:B/1:C 1oyr/1/1:D/1:E