1p1l/2/2:A/3:A

Sequences
>1p1l-a2-m2-cA (length=102) [Search sequence]
MHNFIYITAPSLEEAERIAKRLLEKKLAACVNIFPIKSFFWWEGKIEAATEFAMIVKTRS
EKFAEVRDEVKAMHSYTTPCICAIPIERGLKEFLDWIDETVE
>1p1l-a2-m3-cA (length=102) [Search sequence]
MHNFIYITAPSLEEAERIAKRLLEKKLAACVNIFPIKSFFWWEGKIEAATEFAMIVKTRS
EKFAEVRDEVKAMHSYTTPCICAIPIERGLKEFLDWIDETVE
Structure information
PDB ID 1p1l (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the Periplasmic divalent cation tolerance protein CutA from Archaeoglobus fulgidus
Assembly ID 2
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 81
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession O28301 O28301
Species 2234 (Archaeoglobus fulgidus) 2234 (Archaeoglobus fulgidus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1p1l-a2-m2-cA_1p1l-a2-m3-cA.pdb.gz
Full biological assembly
Download: 1p1l-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1p1l/2/1:A/2:A 1p1l/2/1:A/3:A

[Back to Home]