1p3h/3/1:C/1:H

Sequences

>1p3h-a3-m1-cC (length=98) [Search sequence]

KVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLD VAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK

>1p3h-a3-m1-cH (length=99) [Search sequence]

AKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPL DVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK

Structure information

PDB ID	1p3h (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the Mycobacterium tuberculosis chaperonin 10 tetradecamer
Assembly ID	3
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	62
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	H
UniProt accession	P9WPE5	P9WPE5
Species	1773 (Mycobacterium tuberculosis)	1773 (Mycobacterium tuberculosis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1p3h-a3-m1-cC_1p3h-a3-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1p3h-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1p3h/3/1:B/1:I 1p3h/3/1:D/1:N 1p3h/3/1:E/1:M 1p3h/3/1:J/1:A 1p3h/3/1:K/1:G 1p3h/3/1:L/1:F

Other dimers with similar sequences but different poses

1p3h/3/1:J/1:K 1p3h/1/1:A/1:G 1p3h/1/1:B/1:A 1p3h/1/1:B/1:C 1p3h/1/1:C/1:D 1p3h/1/1:E/1:D 1p3h/1/1:E/1:F 1p3h/1/1:F/1:G 1p3h/2/1:H/1:N 1p3h/2/1:I/1:H 1p3h/2/1:I/1:J 1p3h/2/1:J/1:K 1p3h/2/1:K/1:L 1p3h/2/1:L/1:M 1p3h/2/1:M/1:N 1p3h/3/1:A/1:G 1p3h/3/1:B/1:A 1p3h/3/1:B/1:C 1p3h/3/1:C/1:D 1p3h/3/1:E/1:D 1p3h/3/1:E/1:F 1p3h/3/1:F/1:G 1p3h/3/1:H/1:N 1p3h/3/1:I/1:H 1p3h/3/1:I/1:J 1p3h/3/1:K/1:L 1p3h/3/1:L/1:M 1p3h/3/1:M/1:N 1p3h/3/1:D/1:M 1p3h/3/1:B/1:H 1p3h/3/1:C/1:N 1p3h/3/1:E/1:L 1p3h/3/1:I/1:A 1p3h/3/1:J/1:G 1p3h/3/1:K/1:F