1p3h/3/1:J/1:K

Sequences
>1p3h-a3-m1-cJ (length=98) [Search sequence]
KVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLD
VAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
>1p3h-a3-m1-cK (length=98) [Search sequence]
KVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLD
VAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
Structure information
PDB ID 1p3h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the Mycobacterium tuberculosis chaperonin 10 tetradecamer
Assembly ID 3
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 45
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID J K
UniProt accession P9WPE5 P9WPE5
Species 1773 (Mycobacterium tuberculosis) 1773 (Mycobacterium tuberculosis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1p3h-a3-m1-cJ_1p3h-a3-m1-cK.pdb.gz
Full biological assembly
Download: 1p3h-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1p3h/1/1:A/1:G 1p3h/1/1:B/1:A 1p3h/1/1:B/1:C 1p3h/1/1:C/1:D 1p3h/1/1:E/1:D 1p3h/1/1:E/1:F 1p3h/1/1:F/1:G 1p3h/2/1:H/1:N 1p3h/2/1:I/1:H 1p3h/2/1:I/1:J 1p3h/2/1:J/1:K 1p3h/2/1:K/1:L 1p3h/2/1:L/1:M 1p3h/2/1:M/1:N 1p3h/3/1:A/1:G 1p3h/3/1:B/1:A 1p3h/3/1:B/1:C 1p3h/3/1:C/1:D 1p3h/3/1:E/1:D 1p3h/3/1:E/1:F 1p3h/3/1:F/1:G 1p3h/3/1:H/1:N 1p3h/3/1:I/1:H 1p3h/3/1:I/1:J 1p3h/3/1:K/1:L 1p3h/3/1:L/1:M 1p3h/3/1:M/1:N
Other dimers with similar sequences but different poses
  • 1p3h/3/1:D/1:M 1p3h/3/1:B/1:H 1p3h/3/1:C/1:N 1p3h/3/1:E/1:L 1p3h/3/1:I/1:A 1p3h/3/1:J/1:G 1p3h/3/1:K/1:F
  • 1p3h/3/1:C/1:H 1p3h/3/1:B/1:I 1p3h/3/1:D/1:N 1p3h/3/1:E/1:M 1p3h/3/1:J/1:A 1p3h/3/1:K/1:G 1p3h/3/1:L/1:F
  • [Back to Home]