1p3y/2/6:1/8:1

Sequences
>1p3y-a2-m6-c1 (length=171) [Search sequence]
ISILKDKKLLIGICGSISSVGISSYLLYFKSFFKEIRVVMTKTAEDLIPAHTVSYFCDHV
YSEHGENGKRHSHVEIGRWADIYCIIPATANILGQTANGVAMNLVATTVLAHPHNTIFFP
NMNDLMWNKTVVSRNIEQLRKDGHIVIEPVEIMRGLITPDKALLAIEKGFK
>1p3y-a2-m8-c1 (length=171) [Search sequence]
ISILKDKKLLIGICGSISSVGISSYLLYFKSFFKEIRVVMTKTAEDLIPAHTVSYFCDHV
YSEHGENGKRHSHVEIGRWADIYCIIPATANILGQTANGVAMNLVATTVLAHPHNTIFFP
NMNDLMWNKTVVSRNIEQLRKDGHIVIEPVEIMRGLITPDKALLAIEKGFK
Structure information
PDB ID 1p3y (database links: RCSB PDB PDBe PDBj PDBsum)
Title MrsD from Bacillus sp. HIL-Y85/54728
Assembly ID 2
Resolution 2.54Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 53
Sequence identity between the two chains 1.0
PubMed citation 12876343
Chain information
Chain 1 Chain 2
Model ID 6 8
Chain ID 1 1
UniProt accession Q9RC23 Q9RC23
Species 69002 (Bacillus sp. HIL-Y85/54728) 69002 (Bacillus sp. HIL-Y85/54728)
Function annotation BioLiP:1p3y1 BioLiP:1p3y1
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1p3y-a2-m6-c1_1p3y-a2-m8-c1.pdb.gz
Full biological assembly
Download: 1p3y-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1p3y/1/10:1/5:1 1p3y/1/10:1/9:1 1p3y/1/11:1/3:1 1p3y/1/11:1/4:1 1p3y/1/12:1/2:1 1p3y/1/12:1/7:1 1p3y/1/1:1/6:1 1p3y/1/1:1/8:1 1p3y/1/2:1/7:1 1p3y/1/3:1/4:1 1p3y/1/5:1/9:1 1p3y/1/6:1/8:1 1p3y/2/13:1/21:1 1p3y/2/13:1/28:1 1p3y/2/14:1/22:1 1p3y/2/14:1/27:1 1p3y/2/15:1/20:1 1p3y/2/15:1/29:1 1p3y/2/16:1/26:1 1p3y/2/16:1/32:1 1p3y/2/17:1/24:1 1p3y/2/17:1/31:1 1p3y/2/18:1/23:1 1p3y/2/18:1/33:1 1p3y/2/19:1/25:1 1p3y/2/19:1/30:1 1p3y/2/1:1/6:1 1p3y/2/1:1/8:1 1p3y/2/20:1/29:1 1p3y/2/21:1/28:1 1p3y/2/22:1/27:1 1p3y/2/23:1/33:1 1p3y/2/24:1/31:1 1p3y/2/25:1/30:1 1p3y/2/26:1/32:1
Other dimers with similar sequences but different poses
  • 1p3y/1/6:1/9:1 1p3y/1/10:1/7:1 1p3y/1/11:1/5:1 1p3y/1/12:1/3:1 1p3y/1/1:1/4:1 1p3y/1/2:1/8:1
  • 1p3y/2/18:1/8:1 1p3y/2/13:1/23:1 1p3y/2/14:1/26:1 1p3y/2/15:1/24:1 1p3y/2/16:1/29:1 1p3y/2/17:1/27:1 1p3y/2/19:1/28:1 1p3y/2/1:1/25:1 1p3y/2/20:1/33:1 1p3y/2/21:1/31:1 1p3y/2/22:1/30:1 1p3y/2/32:1/6:1
  • [Back to Home]