1p65/1/1:A/1:B

Sequences
>1p65-a1-m1-cA (length=57) [Search sequence]
DVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVT
>1p65-a1-m1-cB (length=57) [Search sequence]
DVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVT
Structure information
PDB ID 1p65 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus (PRRSV)
Assembly ID 1
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 93
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q9YJI1 Q9YJI1
Species 28344 (Porcine reproductive and respiratory syndrome virus) 28344 (Porcine reproductive and respiratory syndrome virus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1p65-a1-m1-cA_1p65-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1p65-assembly1.cif.gz

[Back to Home]