1pd3/3/1:A/1:B

Sequences
>1pd3-a3-m1-cA (length=54) [Search sequence]
GKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTF
>1pd3-a3-m1-cB (length=54) [Search sequence]
GKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTF
Structure information
PDB ID 1pd3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Influenza A NEP M1-binding domain
Assembly ID 3
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 55
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P03508 P03508
Species 11320 (Influenza A virus) 11320 (Influenza A virus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1pd3-a3-m1-cA_1pd3-a3-m1-cB.pdb.gz
Full biological assembly
Download: 1pd3-assembly3.cif.gz

[Back to Home]